CN112220919A - Nano coronavirus recombinant vaccine taking graphene oxide as carrier - Google Patents
Nano coronavirus recombinant vaccine taking graphene oxide as carrier Download PDFInfo
- Publication number
- CN112220919A CN112220919A CN202011031367.1A CN202011031367A CN112220919A CN 112220919 A CN112220919 A CN 112220919A CN 202011031367 A CN202011031367 A CN 202011031367A CN 112220919 A CN112220919 A CN 112220919A
- Authority
- CN
- China
- Prior art keywords
- cpg
- coronavirus
- graphene oxide
- vaccine
- carnosine
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 title claims abstract description 35
- 241000711573 Coronaviridae Species 0.000 title claims abstract description 34
- 229910021389 graphene Inorganic materials 0.000 title claims abstract description 31
- 108010008038 Synthetic Vaccines Proteins 0.000 title description 6
- 229940124551 recombinant vaccine Drugs 0.000 title description 6
- 229960005486 vaccine Drugs 0.000 claims abstract description 54
- CQOVPNPJLQNMDC-UHFFFAOYSA-N N-beta-alanyl-L-histidine Natural products NCCC(=O)NC(C(O)=O)CC1=CN=CN1 CQOVPNPJLQNMDC-UHFFFAOYSA-N 0.000 claims abstract description 24
- CQOVPNPJLQNMDC-ZETCQYMHSA-N carnosine Chemical compound [NH3+]CCC(=O)N[C@H](C([O-])=O)CC1=CNC=N1 CQOVPNPJLQNMDC-ZETCQYMHSA-N 0.000 claims abstract description 24
- QRYRORQUOLYVBU-VBKZILBWSA-N Carnosic acid Natural products CC([C@@H]1CC2)(C)CCC[C@]1(C(O)=O)C1=C2C=C(C(C)C)C(O)=C1O QRYRORQUOLYVBU-VBKZILBWSA-N 0.000 claims abstract description 23
- 108010087806 Carnosine Proteins 0.000 claims abstract description 23
- 229940044199 carnosine Drugs 0.000 claims abstract description 23
- 102000005962 receptors Human genes 0.000 claims abstract description 8
- 108020003175 receptors Proteins 0.000 claims abstract description 8
- 238000002360 preparation method Methods 0.000 claims abstract description 7
- 108091026890 Coding region Proteins 0.000 claims abstract description 4
- 230000002265 prevention Effects 0.000 claims abstract description 4
- 239000000243 solution Substances 0.000 claims description 25
- 238000006243 chemical reaction Methods 0.000 claims description 16
- 238000000034 method Methods 0.000 claims description 16
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 claims description 12
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 claims description 12
- 238000000108 ultra-filtration Methods 0.000 claims description 8
- 102000004169 proteins and genes Human genes 0.000 claims description 7
- 108090000623 proteins and genes Proteins 0.000 claims description 7
- RPENMORRBUTCPR-UHFFFAOYSA-M sodium;1-hydroxy-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].ON1C(=O)CC(S([O-])(=O)=O)C1=O RPENMORRBUTCPR-UHFFFAOYSA-M 0.000 claims description 6
- 239000003814 drug Substances 0.000 claims description 4
- 239000008363 phosphate buffer Substances 0.000 claims description 4
- 102100031673 Corneodesmosin Human genes 0.000 claims description 3
- 101710139375 Corneodesmosin Proteins 0.000 claims description 3
- 230000007935 neutral effect Effects 0.000 claims description 3
- 239000000843 powder Substances 0.000 claims description 3
- 239000008055 phosphate buffer solution Substances 0.000 claims description 2
- 238000009210 therapy by ultrasound Methods 0.000 claims description 2
- 108700023317 Coronavirus Receptors Proteins 0.000 claims 4
- 238000000527 sonication Methods 0.000 claims 1
- 238000011161 development Methods 0.000 abstract description 8
- 238000011282 treatment Methods 0.000 abstract description 7
- 238000002474 experimental method Methods 0.000 abstract description 5
- 241001678559 COVID-19 virus Species 0.000 abstract description 4
- 241001465754 Metazoa Species 0.000 abstract description 3
- 239000002086 nanomaterial Substances 0.000 abstract description 3
- 108700010904 coronavirus proteins Proteins 0.000 abstract description 2
- 229940046168 CpG oligodeoxynucleotide Drugs 0.000 description 28
- LMDZBCPBFSXMTL-UHFFFAOYSA-N 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide Chemical compound CCN=C=NCCCN(C)C LMDZBCPBFSXMTL-UHFFFAOYSA-N 0.000 description 11
- 239000002671 adjuvant Substances 0.000 description 10
- 241000699670 Mus sp. Species 0.000 description 8
- 210000004369 blood Anatomy 0.000 description 8
- 239000008280 blood Substances 0.000 description 8
- 230000000694 effects Effects 0.000 description 7
- 241000699666 Mus <mouse, genus> Species 0.000 description 6
- 241000282414 Homo sapiens Species 0.000 description 5
- 230000028993 immune response Effects 0.000 description 5
- 239000000463 material Substances 0.000 description 5
- 238000011160 research Methods 0.000 description 5
- 208000025370 Middle East respiratory syndrome Diseases 0.000 description 4
- 241000700605 Viruses Species 0.000 description 4
- 230000036039 immunity Effects 0.000 description 4
- 208000015181 infectious disease Diseases 0.000 description 4
- 229940126583 recombinant protein vaccine Drugs 0.000 description 4
- 238000012360 testing method Methods 0.000 description 4
- UHOVQNZJYSORNB-UHFFFAOYSA-N Benzene Chemical compound C1=CC=CC=C1 UHOVQNZJYSORNB-UHFFFAOYSA-N 0.000 description 3
- 208000035473 Communicable disease Diseases 0.000 description 3
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 230000002708 enhancing effect Effects 0.000 description 3
- 230000003053 immunization Effects 0.000 description 3
- 238000002649 immunization Methods 0.000 description 3
- 230000002163 immunogen Effects 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- XMIAMUXIMWREBJ-HERUPUMHSA-N Ala-Trp-Asn Chemical compound C[C@@H](C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)N[C@@H](CC(=O)N)C(=O)O)N XMIAMUXIMWREBJ-HERUPUMHSA-N 0.000 description 2
- 208000001528 Coronaviridae Infections Diseases 0.000 description 2
- 108090000695 Cytokines Proteins 0.000 description 2
- 102000004127 Cytokines Human genes 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- 229940096437 Protein S Drugs 0.000 description 2
- 101710198474 Spike protein Proteins 0.000 description 2
- 210000001744 T-lymphocyte Anatomy 0.000 description 2
- 102000008235 Toll-Like Receptor 9 Human genes 0.000 description 2
- 108010060818 Toll-Like Receptor 9 Proteins 0.000 description 2
- -1 and after oxidation Chemical compound 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- UCMIRNVEIXFBKS-UHFFFAOYSA-N beta-alanine Chemical compound NCCC(O)=O UCMIRNVEIXFBKS-UHFFFAOYSA-N 0.000 description 2
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 2
- 210000004027 cell Anatomy 0.000 description 2
- 201000010099 disease Diseases 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- 230000007787 long-term memory Effects 0.000 description 2
- 239000008176 lyophilized powder Substances 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 229940046166 oligodeoxynucleotide Drugs 0.000 description 2
- 238000007254 oxidation reaction Methods 0.000 description 2
- 239000003642 reactive oxygen metabolite Substances 0.000 description 2
- 210000004989 spleen cell Anatomy 0.000 description 2
- 210000004988 splenocyte Anatomy 0.000 description 2
- CWFMWBHMIMNZLN-NAKRPEOUSA-N (2s)-1-[(2s)-2-[[(2s,3s)-2-amino-3-methylpentanoyl]amino]propanoyl]pyrrolidine-2-carboxylic acid Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(O)=O CWFMWBHMIMNZLN-NAKRPEOUSA-N 0.000 description 1
- NHBKXEKEPDILRR-UHFFFAOYSA-N 2,3-bis(butanoylsulfanyl)propyl butanoate Chemical compound CCCC(=O)OCC(SC(=O)CCC)CSC(=O)CCC NHBKXEKEPDILRR-UHFFFAOYSA-N 0.000 description 1
- BUDNAJYVCUHLSV-ZLUOBGJFSA-N Ala-Asp-Ser Chemical compound C[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(O)=O BUDNAJYVCUHLSV-ZLUOBGJFSA-N 0.000 description 1
- KUDREHRZRIVKHS-UWJYBYFXSA-N Ala-Asp-Tyr Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O KUDREHRZRIVKHS-UWJYBYFXSA-N 0.000 description 1
- IYMAXBFPHPZYIK-BQBZGAKWSA-N Arg-Gly-Asp Chemical compound NC(N)=NCCC[C@H](N)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(O)=O IYMAXBFPHPZYIK-BQBZGAKWSA-N 0.000 description 1
- FSNVAJOPUDVQAR-AVGNSLFASA-N Arg-Lys-Arg Chemical compound NC(=N)NCCC[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O FSNVAJOPUDVQAR-AVGNSLFASA-N 0.000 description 1
- CZUHPNLXLWMYMG-UBHSHLNASA-N Arg-Phe-Ala Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](C)C(O)=O)CC1=CC=CC=C1 CZUHPNLXLWMYMG-UBHSHLNASA-N 0.000 description 1
- RTFXPCYMDYBZNQ-SRVKXCTJSA-N Asn-Tyr-Asn Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(O)=O RTFXPCYMDYBZNQ-SRVKXCTJSA-N 0.000 description 1
- QNNBHTFDFFFHGC-KKUMJFAQSA-N Asn-Tyr-Lys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@H](CC(=O)N)N)O QNNBHTFDFFFHGC-KKUMJFAQSA-N 0.000 description 1
- HBUJSDCLZCXXCW-YDHLFZDLSA-N Asn-Val-Tyr Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 HBUJSDCLZCXXCW-YDHLFZDLSA-N 0.000 description 1
- KLYPOCBLKMPBIQ-GHCJXIJMSA-N Asp-Ile-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CC(=O)O)N KLYPOCBLKMPBIQ-GHCJXIJMSA-N 0.000 description 1
- VNXQRBXEQXLERQ-CIUDSAMLSA-N Asp-Ser-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(=O)O)N VNXQRBXEQXLERQ-CIUDSAMLSA-N 0.000 description 1
- 238000011725 BALB/c mouse Methods 0.000 description 1
- OIMUAKUQOUEPCZ-WHFBIAKZSA-N Cys-Asn-Gly Chemical compound SC[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O OIMUAKUQOUEPCZ-WHFBIAKZSA-N 0.000 description 1
- CNAMJJOZGXPDHW-IHRRRGAJSA-N Cys-Pro-Phe Chemical compound N[C@@H](CS)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(O)=O CNAMJJOZGXPDHW-IHRRRGAJSA-N 0.000 description 1
- NGOIQDYZMIKCOK-NAKRPEOUSA-N Cys-Val-Ile Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O NGOIQDYZMIKCOK-NAKRPEOUSA-N 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 108010016626 Dipeptides Proteins 0.000 description 1
- 108060002716 Exonuclease Proteins 0.000 description 1
- HHWQMFIGMMOVFK-WDSKDSINSA-N Gln-Ala-Gly Chemical compound OC(=O)CNC(=O)[C@H](C)NC(=O)[C@@H](N)CCC(N)=O HHWQMFIGMMOVFK-WDSKDSINSA-N 0.000 description 1
- GHAXJVNBAKGWEJ-AVGNSLFASA-N Gln-Ser-Tyr Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O GHAXJVNBAKGWEJ-AVGNSLFASA-N 0.000 description 1
- MLILEEIVMRUYBX-NHCYSSNCSA-N Glu-Val-Arg Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O MLILEEIVMRUYBX-NHCYSSNCSA-N 0.000 description 1
- NPSWCZIRBAYNSB-JHEQGTHGSA-N Gly-Gln-Thr Chemical compound [H]NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(O)=O NPSWCZIRBAYNSB-JHEQGTHGSA-N 0.000 description 1
- JSNNHGHYGYMVCK-XVKPBYJWSA-N Gly-Glu-Val Chemical compound [H]NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O JSNNHGHYGYMVCK-XVKPBYJWSA-N 0.000 description 1
- PTIIBFKSLCYQBO-NHCYSSNCSA-N Gly-Lys-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)CN PTIIBFKSLCYQBO-NHCYSSNCSA-N 0.000 description 1
- YYXJFBMCOUSYSF-RYUDHWBXSA-N Gly-Phe-Gln Chemical compound [H]NCC(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(N)=O)C(O)=O YYXJFBMCOUSYSF-RYUDHWBXSA-N 0.000 description 1
- RYAOJUMWLWUGNW-QMMMGPOBSA-N Gly-Val-Gly Chemical compound NCC(=O)N[C@@H](C(C)C)C(=O)NCC(O)=O RYAOJUMWLWUGNW-QMMMGPOBSA-N 0.000 description 1
- SBVMXEZQJVUARN-XPUUQOCRSA-N Gly-Val-Ser Chemical compound NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(O)=O SBVMXEZQJVUARN-XPUUQOCRSA-N 0.000 description 1
- JBCLFWXMTIKCCB-UHFFFAOYSA-N H-Gly-Phe-OH Natural products NCC(=O)NC(C(O)=O)CC1=CC=CC=C1 JBCLFWXMTIKCCB-UHFFFAOYSA-N 0.000 description 1
- JODPUDMBQBIWCK-GHCJXIJMSA-N Ile-Ser-Asn Chemical compound [H]N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O JODPUDMBQBIWCK-GHCJXIJMSA-N 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- PMGDADKJMCOXHX-UHFFFAOYSA-N L-Arginyl-L-glutamin-acetat Natural products NC(=N)NCCCC(N)C(=O)NC(CCC(N)=O)C(O)=O PMGDADKJMCOXHX-UHFFFAOYSA-N 0.000 description 1
- VCSBGUACOYUIGD-CIUDSAMLSA-N Leu-Asn-Asp Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O VCSBGUACOYUIGD-CIUDSAMLSA-N 0.000 description 1
- YORLGJINWYYIMX-KKUMJFAQSA-N Leu-Cys-Phe Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O YORLGJINWYYIMX-KKUMJFAQSA-N 0.000 description 1
- RTIRBWJPYJYTLO-MELADBBJSA-N Leu-Lys-Pro Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@@H]1C(=O)O)N RTIRBWJPYJYTLO-MELADBBJSA-N 0.000 description 1
- GCXGCIYIHXSKAY-ULQDDVLXSA-N Leu-Phe-Arg Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O GCXGCIYIHXSKAY-ULQDDVLXSA-N 0.000 description 1
- WUHBLPVELFTPQK-KKUMJFAQSA-N Leu-Tyr-Asn Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(O)=O WUHBLPVELFTPQK-KKUMJFAQSA-N 0.000 description 1
- DZQYZKPINJLLEN-KKUMJFAQSA-N Lys-Cys-Tyr Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](CCCCN)N)O DZQYZKPINJLLEN-KKUMJFAQSA-N 0.000 description 1
- GHKXHCMRAUYLBS-CIUDSAMLSA-N Lys-Ser-Asn Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O GHKXHCMRAUYLBS-CIUDSAMLSA-N 0.000 description 1
- 201000005505 Measles Diseases 0.000 description 1
- GUVMFDICMFQHSZ-UHFFFAOYSA-N N-(1-aminoethenyl)-1-[4-[[5-(4-amino-5-methyl-2-oxopyrimidin-1-yl)-3-[[5-(4-amino-5-methyl-2-oxopyrimidin-1-yl)-3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(4-amino-5-methyl-2-oxopyrimidin-1-yl)-3-[[5-(4-amino-5-methyl-2-oxopyrimidin-1-yl)-3-[[5-(4-amino-5-methyl-2-oxopyrimidin-1-yl)-3-[[5-(4-amino-5-methyl-2-oxopyrimidin-1-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[hydroxy-[[3-[hydroxy-[[3-hydroxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy]phosphinothioyl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy]phosphinothioyl]oxyoxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxyoxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxyoxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxyoxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxyoxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxyoxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-(2-amino-6-oxo-1H-purin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-(2-amino-6-oxo-1H-purin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxyoxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxyoxolan-2-yl]methoxy-hydroxyphosphinothioyl]oxy-5-[[[2-[[[2-[[[5-(2-amino-6-oxo-1H-purin-9-yl)-2-[[[5-(4-amino-2-oxopyrimidin-1-yl)-2-[[hydroxy-[2-(hydroxymethyl)-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-3-yl]oxyphosphinothioyl]oxymethyl]oxolan-3-yl]oxy-hydroxyphosphinothioyl]oxymethyl]oxolan-3-yl]oxy-hydroxyphosphinothioyl]oxymethyl]-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-3-yl]oxy-hydroxyphosphinothioyl]oxymethyl]-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-3-yl]oxy-hydroxyphosphinothioyl]oxymethyl]oxolan-2-yl]-5-methylimidazole-4-carboxamide Chemical compound CC1=C(C(=O)NC(N)=C)N=CN1C1OC(COP(O)(=S)OC2C(OC(C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=S)OC2C(OC(C2)N2C(N=C(N)C=C2)=O)COP(O)(=S)OC2C(OC(C2)N2C(NC(=O)C(C)=C2)=O)CO)C(OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C3=C(C(NC(N)=N3)=O)N=C2)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C3=C(C(NC(N)=N3)=O)N=C2)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C3=C(C(NC(N)=N3)=O)N=C2)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C3=C(C(NC(N)=N3)=O)N=C2)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)O)C1 GUVMFDICMFQHSZ-UHFFFAOYSA-N 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- QCHNRQQVLJYDSI-DLOVCJGASA-N Phe-Asn-Ala Chemical compound OC(=O)[C@H](C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)CC1=CC=CC=C1 QCHNRQQVLJYDSI-DLOVCJGASA-N 0.000 description 1
- UUWCIPUVJJIEEP-SRVKXCTJSA-N Phe-Asn-Cys Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CS)C(=O)O)N UUWCIPUVJJIEEP-SRVKXCTJSA-N 0.000 description 1
- HOYQLNNGMHXZDW-KKUMJFAQSA-N Phe-Glu-Arg Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O HOYQLNNGMHXZDW-KKUMJFAQSA-N 0.000 description 1
- WWPAHTZOWURIMR-ULQDDVLXSA-N Phe-Pro-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CC1=CC=CC=C1 WWPAHTZOWURIMR-ULQDDVLXSA-N 0.000 description 1
- IAOZOFPONWDXNT-IXOXFDKPSA-N Phe-Ser-Thr Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(O)=O IAOZOFPONWDXNT-IXOXFDKPSA-N 0.000 description 1
- BSKMOCNNLNDIMU-CDMKHQONSA-N Phe-Thr-Gly Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(O)=O BSKMOCNNLNDIMU-CDMKHQONSA-N 0.000 description 1
- BQMFWUKNOCJDNV-HJWJTTGWSA-N Phe-Val-Ile Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O BQMFWUKNOCJDNV-HJWJTTGWSA-N 0.000 description 1
- 208000000474 Poliomyelitis Diseases 0.000 description 1
- XWYXZPHPYKRYPA-GMOBBJLQSA-N Pro-Asn-Ile Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O XWYXZPHPYKRYPA-GMOBBJLQSA-N 0.000 description 1
- ILMLVTGTUJPQFP-FXQIFTODSA-N Pro-Asp-Asp Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O ILMLVTGTUJPQFP-FXQIFTODSA-N 0.000 description 1
- WVXQQUWOKUZIEG-VEVYYDQMSA-N Pro-Thr-Asn Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(O)=O WVXQQUWOKUZIEG-VEVYYDQMSA-N 0.000 description 1
- AJJDPGVVNPUZCR-RHYQMDGZSA-N Pro-Thr-Lys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@@H]1CCCN1)O AJJDPGVVNPUZCR-RHYQMDGZSA-N 0.000 description 1
- 108091005634 SARS-CoV-2 receptor-binding domains Proteins 0.000 description 1
- YQHZVYJAGWMHES-ZLUOBGJFSA-N Ser-Ala-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O YQHZVYJAGWMHES-ZLUOBGJFSA-N 0.000 description 1
- OOKCGAYXSNJBGQ-ZLUOBGJFSA-N Ser-Asn-Asn Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O OOKCGAYXSNJBGQ-ZLUOBGJFSA-N 0.000 description 1
- ZSDXEKUKQAKZFE-XAVMHZPKSA-N Ser-Thr-Pro Chemical compound C[C@H]([C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CO)N)O ZSDXEKUKQAKZFE-XAVMHZPKSA-N 0.000 description 1
- ODRUTDLAONAVDV-IHRRRGAJSA-N Ser-Val-Tyr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O ODRUTDLAONAVDV-IHRRRGAJSA-N 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- SKHPKKYKDYULDH-HJGDQZAQSA-N Thr-Asn-Leu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(O)=O SKHPKKYKDYULDH-HJGDQZAQSA-N 0.000 description 1
- JMGJDTNUMAZNLX-RWRJDSDZSA-N Thr-Glu-Ile Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O JMGJDTNUMAZNLX-RWRJDSDZSA-N 0.000 description 1
- OLYXUGBVBGSZDN-ACRUOGEOSA-N Tyr-Leu-Tyr Chemical compound C([C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=C(O)C=C1 OLYXUGBVBGSZDN-ACRUOGEOSA-N 0.000 description 1
- TYFLVOUZHQUBGM-IHRRRGAJSA-N Tyr-Ser-Val Chemical compound CC(C)[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 TYFLVOUZHQUBGM-IHRRRGAJSA-N 0.000 description 1
- FZSPNKUFROZBSG-ZKWXMUAHSA-N Val-Ala-Asp Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC(O)=O FZSPNKUFROZBSG-ZKWXMUAHSA-N 0.000 description 1
- VVZDBPBZHLQPPB-XVKPBYJWSA-N Val-Glu-Gly Chemical compound CC(C)[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O VVZDBPBZHLQPPB-XVKPBYJWSA-N 0.000 description 1
- PIFJAFRUVWZRKR-QMMMGPOBSA-N Val-Gly-Gly Chemical compound CC(C)[C@H]([NH3+])C(=O)NCC(=O)NCC([O-])=O PIFJAFRUVWZRKR-QMMMGPOBSA-N 0.000 description 1
- GBIUHAYJGWVNLN-UHFFFAOYSA-N Val-Ser-Pro Natural products CC(C)C(N)C(=O)NC(CO)C(=O)N1CCCC1C(O)=O GBIUHAYJGWVNLN-UHFFFAOYSA-N 0.000 description 1
- 241000700647 Variola virus Species 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 230000033289 adaptive immune response Effects 0.000 description 1
- 108010024078 alanyl-glycyl-serine Proteins 0.000 description 1
- 108010069020 alanyl-prolyl-glycine Proteins 0.000 description 1
- 150000001299 aldehydes Chemical class 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 229940024606 amino acid Drugs 0.000 description 1
- 150000001413 amino acids Chemical class 0.000 description 1
- 239000000427 antigen Substances 0.000 description 1
- 102000036639 antigens Human genes 0.000 description 1
- 108091007433 antigens Proteins 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 230000003078 antioxidant effect Effects 0.000 description 1
- 108010008355 arginyl-glutamine Proteins 0.000 description 1
- 108010072041 arginyl-glycyl-aspartic acid Proteins 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 229940000635 beta-alanine Drugs 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 125000004432 carbon atom Chemical group C* 0.000 description 1
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 229940028617 conventional vaccine Drugs 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 108010069495 cysteinyltyrosine Proteins 0.000 description 1
- 230000016396 cytokine production Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 206010013023 diphtheria Diseases 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 230000009982 effect on human Effects 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 125000003700 epoxy group Chemical group 0.000 description 1
- 230000008029 eradication Effects 0.000 description 1
- 102000013165 exonuclease Human genes 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- XBGGUPMXALFZOT-UHFFFAOYSA-N glycyl-L-tyrosine hemihydrate Natural products NCC(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 XBGGUPMXALFZOT-UHFFFAOYSA-N 0.000 description 1
- 108010081551 glycylphenylalanine Proteins 0.000 description 1
- 108010087823 glycyltyrosine Proteins 0.000 description 1
- 108010037850 glycylvaline Proteins 0.000 description 1
- SPSXSWRZQFPVTJ-ZQQKUFEYSA-N hepatitis b vaccine Chemical compound C([C@H](NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CCSC)C(=O)N[C@@H](CC1N=CN=C1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)OC(=O)CNC(=O)CNC(=O)[C@H](C)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@@H](N)CCCNC(N)=N)C1=CC=CC=C1 SPSXSWRZQFPVTJ-ZQQKUFEYSA-N 0.000 description 1
- 229940124736 hepatitis-B vaccine Drugs 0.000 description 1
- 229960002885 histidine Drugs 0.000 description 1
- 230000028996 humoral immune response Effects 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 230000005934 immune activation Effects 0.000 description 1
- 210000002865 immune cell Anatomy 0.000 description 1
- 230000006054 immunological memory Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 108010044374 isoleucyl-tyrosine Proteins 0.000 description 1
- 108010053037 kyotorphin Proteins 0.000 description 1
- 230000002045 lasting effect Effects 0.000 description 1
- 108010090333 leucyl-lysyl-proline Proteins 0.000 description 1
- 108010017391 lysylvaline Proteins 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 210000001806 memory b lymphocyte Anatomy 0.000 description 1
- 239000000203 mixture Substances 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 230000016379 mucosal immune response Effects 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 150000007523 nucleic acids Chemical group 0.000 description 1
- 239000011368 organic material Substances 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 230000036542 oxidative stress Effects 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 229940031626 subunit vaccine Drugs 0.000 description 1
- 206010043378 tetanus neonatorum Diseases 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 108010061238 threonyl-glycine Proteins 0.000 description 1
- 238000002604 ultrasonography Methods 0.000 description 1
- 238000002255 vaccination Methods 0.000 description 1
- 229940023147 viral vector vaccine Drugs 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/385—Haptens or antigens, bound to carriers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K17/00—Carrier-bound or immobilised peptides; Preparation thereof
- C07K17/14—Peptides being immobilised on, or in, an inorganic carrier
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55561—CpG containing adjuvants; Oligonucleotide containing adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/62—Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier
- A61K2039/627—Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier characterised by the linker
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/20011—Coronaviridae
- C12N2770/20022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/20011—Coronaviridae
- C12N2770/20034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Abstract
The invention belongs to the field of nano materials and biomedicine, and relates to a vaccine, in particular to development of 2019-nCoV coronavirus nuclear recombinant nano vaccine. The invention also comprises a preparation method of the vaccine and application of the vaccine in animal experiments. The new corona vaccine contains graphene oxide, carnosine, CpG and new corona virus RBD; binding carnosine, CpG and neocoronavirus RBD on the backbone of graphene oxide; the CpG coding sequence is shown as SEQ ID NO 1; the novel coronavirus RBD refers to a novel coronavirus protein receptor binding region which can generate a high-titer specific antibody aiming at the RBD in a mouse body, and provides a strong support for prevention and treatment of the novel coronavirus.
Description
Technical Field
The invention belongs to the field of nano materials and biomedicine, and relates to development of a vaccine development platform. In particular to the development of 2019-nCoV coronavirus nuclear recombinant nano-vaccine. The invention also includes the use of the vaccine in animal testing.
Technical Field
The vaccine is an ultimate weapon for eliminating major infectious diseases, has the advantages of lowest cost and more advantages of prior enemy than other therapies, undoubtedly becomes hopeful to the public, the smallpox is eliminated by human beings through vaccination, the poliomyelitis cases are reduced by 99 percent, the infectious diseases such as diphtheria are rare, and the incidence rate of diseases such as measles, neonatal tetanus and the like is remarkably reduced. The effect of vaccines on human health is not excessive, and the birth of each new vaccine is a great victory for human beings to overcome an infectious disease! To date, no medical treatment has been able to have such an important, lasting and profound effect on human health as a vaccine; nor is any therapeutic available to eliminate a disease from the earth at the very least cost of a vaccine.
After the occurrence of SARS-CoV-2 epidemic, different laboratories in China have completed the isolation of virus strains, and in order to make a big step forward in vaccine development, we believe that we will soon have a final weapon for the eradication of SARS-CoV-2, however, until now there is no approved vaccine or drug for the treatment of CoV infection, and there is a great need to develop an effective drug for the treatment or prevention of coronavirus infection and outbreak.
According to the research of coronavirus vaccines such as SARS and MERS, the main target point of the existing coronavirus vaccine is the S protein of coronavirus. Vaccines need to induce not only humoral and cellular immune responses, but also mucosal immune responses, and with the aid of adjuvants to induce balanced Th1 and Th2 pathways to produce truly effective vaccines. At present, the research of more SARS and MERS vaccines mainly focuses on viral vector vaccines and subunit vaccines, and a large number of researches show that the difficulty of SARS and MERS lies in that long-term memory B cells cannot be stimulated to generate, the long-term memory cells in the healed SARS and MERS patients can only last for 2-3 years, immunological memory cannot be generated, and the vaccine development failure is caused, and only 6 potential coronavirus vaccines enter the clinical research stage at present, but no 1 effective vaccine is approved to be marketed.
Disclosure of Invention
The invention aims to provide a coronavirus recombinant vaccine.
Another purpose of the invention is to provide a preparation method of the virus recombinant vaccine.
It is still another object of the present invention to provide the use of the recombinant vaccine of the virus.
In view of various problems of the conventional vaccines at present, how to change the problems of the existing vaccines and enhance immune response is a problem which is always considered, in order to improve the immunocompetence of the immunogen and enhance the immune response capability of the body, the most basic method is to mix the immunogen with an adjuvant, and the immune adjuvant is a promoter capable of enhancing the immune response of the body to the immunogen. CpG Oligodeoxynucleotide (ODN) is a very promising adjuvant discovered in recent years. CpG ODN has been shown to have better adjuvant activity in vivo, in vitro and clinical studies in animals, and the best studies are CpG7909 and CpG 1018. 11/9.2017, the hepatitis B vaccine approved by Dynavax Technologies of the United states of America FDA and using CpG1018 as an adjuvant is on the market, is the first approved CpG ODN adjuvant vaccine in the world and is used for preventing HBV infection of adults 18 years old and older, and a plurality of different types of CpG ODN are used as adjuvants in a plurality of clinical trials. CpG is combined with TLR9 to activate immature pDC cells and induce natural and adaptive immune response, but a single CpG structure has limited activation effect on immune cells and is easy to be rapidly hydrolyzed by exonuclease, so that the stability of the CpG in vivo is insufficient, and side effects are also caused; CpG Oligodeoxynucleotide (ODN) synthesized in the sequence can also enhance the stimulation effect, and after the CpG is coupled with other proteins such as antigen and the like, the CpG oligodeoxynucleotide is combined, so that the CpG oligodeoxynucleotide has a very obvious immune activation effect.
Graphene is a two-dimensional carbon nanomaterial consisting of carbon atoms in sp hybridized orbitals in a hexagonal honeycomb lattice. The basic structural unit of the material is the most stable benzene six-membered ring in the organic material, and the material is the most ideal two-dimensional material at present. Graphene Oxide (GO) is a Graphene oxide derivative, and is a exfoliated product. Due to the characteristics of unique SP2 hybridization, a perfect two-dimensional structure and high reactivity of the edge, the treatment platform based on the hybrid structure can be used as an ideal load and grafting carrier in design and development, and plays an important role in aspects of nano-drug delivery systems, biological detection, tumor treatment, cell imaging and the like.
The present invention has been completed based on the above-mentioned studies.
The invention discloses a brand-new vaccine development method based on a graphene oxide material serving as a framework for loading CpG molecules and recombinant proteins. Based on the technical platform, a new nano new crown vaccine is prepared by combining the recombinant protein of the RBD region of the Spike protein of the SAR-CoV-2. The prepared nano new corona vaccine has stronger immunogenicity in mouse experiments and can generate high-titer antibodies.
In one aspect, the invention provides a coronavirus vaccine comprising graphene oxide, carnosine, CpG, and RBD. In a preferred embodiment of the invention, the vaccine is named GO-Car-carnosine-CpG-RBD vaccine.
Graphene Oxide (GO) is an oxide of graphene, and after oxidation, oxygen-containing functional groups on the graphene oxide are increased, so that the graphene oxide is more active than graphene. For example, hydroxyl groups and epoxy groups are randomly distributed on a graphene oxide monolith, while carboxyl groups and carbonyl groups are introduced at the edge of the monolith. Common commercial products of graphene oxide are in the form of powder, flakes and solutions, and are brown-yellow in color.
Carnosine, known by the scientific name β -alanyl-L-histidine, is a crystalline solid composed of a dipeptide consisting of two amino acids, β -alanine and L-histidine. Carnosine has strong antioxidant ability, and can scavenge Reactive Oxygen Species (ROS) and alpha-beta unsaturated aldehydes, which are formed by over-oxidation of fatty acids in cell membranes during oxidative stress.
CpG motifs have the effect of activating the body's immune system and can be used as adjuvants. Preferably, the CpG coding sequence is shown as SEQ ID NO 1.
RBD (spike receptor binding domain), specifically a coronavirus protein (S protein) Receptor Binding Domain (RBD) in the present invention. For example, the RBD protein can be selected as follows:
PNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAP(SEQ ID NO 2)。
the coronavirus vaccine disclosed by the invention is obtained by combining carnosine, CpG and a novel coronavirus RBD on activated graphene oxide.
The dosage of GO in the coronavirus vaccine provided by the invention is used as a framework base, the dosage is usually excessive, and the dosage of carnosine can be about twice of that of GO. CpG and new coronavirus RBD are used as biological macromolecules, and the dosage of the CpG and the new coronavirus RBD is less, and is usually one ten thousandth of that of GO in mass ratio. And RBD is used in an amount more than 2 times that of CpG, such as CpG: RBD = 1: 2-10, preferably, the dosage of RBD is 3-6 times of that of CpG.
In another aspect, the present invention provides a method for preparing the coronavirus vaccine, the method comprising the steps of:
obtaining CpG, RBD recombinant protein and carnosine;
adding freeze-dried GO powder into a phosphate buffer solution, and carrying out ultrasonic treatment;
adding EDC and NHS to activate GO solution, removing excess EDC/sulfo-NHS in the reaction solution through ultrafiltration, and adjusting the pH of the reaction solution to be neutral;
adding carnosine, CpG, and RBD recombinant proteins to the reaction solution, incubating with activated GO;
excess unconjugated protein was removed from the reaction solution and sterilized for use.
Preferably, the duration of the ultrasound is 2 to 3 hours. The ultrasonic conditions were 200W, 40 kHz.
Preferably, the phosphate buffer has a neutral pH, e.g., 6.8 to 7.6, more preferably 7.0 to 7.4, or 7.2.
Preferably, the method of removing excess EDC/sulfo-NHS or unconjugated protein is ultrafiltration.
In a preferred embodiment of the present invention, the ratio of graphene oxide, carnosine, CpG, and RBD is: 26 mg: 40 mg: 1.2. mu.g: (3-6) μ g.
Preferably, the reaction temperature is 20-28 ℃. For example, room temperature is used.
In a preferred embodiment of the present invention, the GO-Car-carnosine-CpG-RBD vaccine is prepared by the following method: GO was coupled to carnosine using a modification of the EDC-NHS reaction, 26mg of GO lyophilized powder was added to 5.20 mL of phosphate buffer (PBS, pH = 7.4) and sonicated (200W, 40 kHz) at 25 ℃ for 3 h. The GO solution was activated by the addition of 6.82 mg EDC (N1- ((ethylimino) methyl-ene) -N3, N3-dimethyl propane-1,3-diamine, Chinese: 1- (3-dimethylaminopropyl) -3-ethylcarbodiimide) and 7.73 mg NHS (N-N-hydroxysuccinimide) at 25 ℃. Excess EDC/sulfo-NHS was removed from the reaction solution by ultrafiltration and the pH of the solution was then adjusted to 7.4. Then, 40mg of carnosine, 1.2ug CpG, and various concentrations of RBD recombinant protein were added to the solution and reacted with activated GO at 25 ℃ for 2 h. Subsequently, excess unconjugated protein was removed from the reaction solution by ultrafiltration. The prepared product is marked as GO-Car-carnosine-CpG-RBD vaccine. Finally, GO-Car-carnosine-CpG-RBD vaccine solution was contacted with sterile filter (0.22 um) and stored in sterile containers at 4 ℃ for subsequent experiments.
The invention establishes a nano recombinant protein vaccine preparation technical platform capable of quickly exciting the human immune system, and can quickly produce a large amount of preventive vaccines after infectious viruses are confirmed. The technical platform fully utilizes the characteristic that the surface of graphene oxide is provided with COOH, hydroxyl and other groups, and utilizes the interaction between pi-pi bonds to assemble the screened RBD recombinant protein, CpG molecules and carnosine together to prepare the nano recombinant protein vaccine based on the graphene oxide as the framework. The vaccine can stimulate an organism to generate a high-titer RBD neutralizing antibody aiming at SAR-CoV-2, and lays a technical foundation for preventing and treating coronavirus infection and future large outbreaks of similar epidemics.
In another aspect, the invention provides an application of the GO-Car-carnosine-CpG-RBD vaccine, namely an application of the GO-Car-carnosine-CpG-RBD vaccine in preparation of a medicine for preventing a new coronavirus.
Preferably, the application of the composition can improve the immunity of organisms to the new coronavirus.
Preferably, the GO-Car-carnosine-CpG-RBD vaccine can generate specific antibodies aiming at RBD, and the specific antibody titer is high. In the embodiment of the invention, the nano neocorona vaccine realizes stronger immunogenicity in a mouse test and can generate high-titer antibodies.
The invention has the beneficial effects that:
a brand-new vaccine technical platform is developed for a framework loaded CpG molecule and recombinant protein based on a graphene oxide material and combined with the recombinant protein of the RBD region of the Spike protein of SAR-CoV-2 to prepare a novel nano coronavirus vaccine, a high-titer specific antibody aiming at the RBD can be generated in a mouse body, and a strong support is provided for prevention and treatment of novel coronavirus.
Drawings
In order to more clearly illustrate the technical solutions in the embodiments of the present application, the drawings needed to be used in the embodiments will be briefly described below, and it is obvious that the drawings in the following description are only some embodiments of the present application, and it is obvious for those skilled in the art to obtain other drawings without creative efforts.
FIG. 1 is a schematic diagram and time schematic representation of GO-Car-carnosine-CpG-RBD vaccine mouse immunization;
FIG. 2 shows the change of specific RBD antibody in
serum
28 days after the mice were immunized and the change of cytokine production by
spleen cells
42 days after the mice were immunized.
Detailed Description
The technical solutions in the embodiments of the present application will be described clearly and completely below, and it should be understood that the described embodiments are only a part of the embodiments of the present application, and not all embodiments. All other embodiments, which can be derived by a person skilled in the art from the embodiments given herein without making any creative effort, shall fall within the protection scope of the present application. Methods and techniques not specifically described may be performed using techniques conventionally known in the art. For example, refer to molecular cloning handbook of cold spring harbor.
Example 1
Preparation process of Graphene Oxide (GO) -carnosine-CpG-RBD recombinant protein vaccine preparation
Selecting a TLR9 receptor nucleic acid sequence CpG ODN M362 which has cross reaction to both human and mouse, wherein the specific sequence is as follows: 5 '-TCGTCGTCGTTC: GAACGACGTTGAT-3' (25 mer, SEQ ID NO 1), coupling GO with carnosine using a modification of the EDC-NHS reaction, 26mg of a lyophilized powder of GO was added to 5.20 mL of phosphate buffer (PBS, pH = 7.4) and sonicated (200W, 40 kHz) at 25 ℃ for 3 h. The GO solution was activated by the addition of 6.82 mg EDC (N1- ((ethylimino) methyl-ene) -N3, N3-dimethyl propane-1,3-diamine, Chinese: 1- (3-dimethylaminopropyl) -3-ethylcarbodiimide) and 7.73 mg NHS (N-N-hydroxysuccinimide) at 25 ℃. Excess EDC/sulfo-NHS was removed from the reaction solution by ultrafiltration and the pH of the solution was then adjusted to 7.4. Then, 40mg of carnosine, 1.2ug CpG, and various concentrations of RBD recombinant protein were added to the solution and reacted with activated GO at 25 ℃ for 2 h. Subsequently, excess unconjugated protein was removed from the reaction solution by ultrafiltration. The prepared product is marked as GO-Car-carnosine-CpG-RBD vaccine. Finally, GO-Car-carnosine-CpG-RBD vaccine solution was contacted with sterile filter (0.22 um) and stored in sterile containers at 4 ℃ for subsequent experiments.
Example 2
Test of Graphene Oxide (GO) -carnosine-CpG-RBD recombinant protein vaccine immunized mice
6-week-old female BALB/c mice were immunized by subcutaneous injection at 0, 14, and 28 days, respectively, for 28 days and 42 days according to the schedule shown in FIG. 1, blood was collected by drawing blood at , and serum was separated and tested for specific antibodies against RBD. Mice were sacrificed at 42 days, splenocytes isolated, and tested for specific T cell immune responses and cytokine secretion.
Grouping and dose determination of immunized mice:
1. (graphene oxide + carnosine) + 1.2ug cpG +3ug RBD
(graphene oxide + carnosine) + 1.2ug cpG +6ug RBD
3. Aluminum hydroxide +6ug RBD (1: 1)
4. 6ug RBD
5. Liposome (lipo) +6ug RBD group
Mouse strains: BALB/c mic (n = 6).
The schedule for immunization of mice with the GO-Car-carnosine-CpG-RBD vaccine is: blood was collected and first immunized as starting point for immunization of mice. And (5) collecting blood for the second time on the 7 th day, and inspecting a new corona virus adding system to master the principle. Collecting blood for the third time on
day
14, and enhancing immunity. Collecting blood for the fourth time on
day
28, enhancing immunity, detecting antibody in serum, and if positive, preparing to collect spleen cells. The fifth blood collection on
day
42, after which the blood was sacrificed and splenocytes were isolated and subjected to cytokine experiments.
The test results show that 3ug and 6ug groups of the GO-Car-carnosine-CpG-RBD vaccine generate high-titer specific antibodies for RBD after mice are immunized, and the GO-Car-carnosine-CpG-RBD vaccine is significantly different from the traditional adjuvant group, the RBD group and the liposome group (figure 2). Further analyzing the specific immune response of the T cells separated from the spleen, the result shows that the GO-Car-carnosine-CpG-RBD vaccine can stimulate the organism to generate specific IFN-gamma cytokines, improve the immunity of the organism and resist the epidemic situation of new coronavirus.
The above description is only for the specific embodiments of the present application, but the scope of the present application is not limited thereto, and any changes or substitutions that can be easily conceived by those skilled in the art within the technical scope of the present disclosure should be covered within the scope of the present application. Therefore, the protection scope of the present application shall be subject to the protection scope of the claims.
SEQUENCE LISTING
<110> Shanghai nanotechnology and applied national center for engineering research Ltd
<120> nano novel coronavirus recombinant vaccine using graphene oxide as carrier
<130> 20200920
<160> 2
<170> PatentIn version 3.5
<210> 1
<211> 25
<212> DNA
<213> Artificial Sequence
<220>
<223> Artificial sequence
<400> 1
tcgtcgtcgt tcgaacgacg ttgat 25
<210> 2
<211> 192
<212> PRT
<213> Artificial Sequence
<220>
<223> Artificial sequence
<400> 2
Pro Asn Ile Thr Asn Leu Cys Pro Phe Gly Glu Val Phe Asn Ala Thr
1 5 10 15
Arg Phe Ala Ser Val Tyr Ala Trp Asn Arg Lys Arg Ile Ser Asn Cys
20 25 30
Val Ala Asp Tyr Ser Val Leu Tyr Asn Ser Ala Ser Phe Ser Thr Phe
35 40 45
Lys Cys Tyr Gly Val Ser Pro Thr Lys Leu Asn Asp Leu Cys Phe Thr
50 55 60
Asn Val Tyr Ala Asp Ser Phe Val Ile Arg Gly Asp Glu Val Arg Gln
65 70 75 80
Ile Ala Pro Gly Gln Thr Gly Lys Ile Ala Asp Tyr Asn Tyr Lys Leu
85 90 95
Pro Asp Asp Phe Thr Gly Cys Val Ile Ala Trp Asn Ser Asn Asn Leu
100 105 110
Asp Ser Lys Val Gly Gly Asn Tyr Asn Tyr Leu Tyr Arg Leu Phe Arg
115 120 125
Lys Ser Asn Leu Lys Pro Phe Glu Arg Asp Ile Ser Thr Glu Ile Tyr
130 135 140
Gln Ala Gly Ser Thr Pro Cys Asn Gly Val Glu Gly Phe Asn Cys Tyr
145 150 155 160
Phe Pro Leu Gln Ser Tyr Gly Phe Gln Pro Thr Asn Gly Val Gly Tyr
165 170 175
Gln Pro Tyr Arg Val Val Val Leu Ser Phe Glu Leu Leu His Ala Pro
180 185 190
Claims (10)
1. A coronavirus vaccine, wherein said coronavirus comprises graphene oxide, carnosine, CpG, and a novel coronavirus receptor binding domain; binding carnosine, CpG, and a novel coronavirus receptor binding region on a backbone of graphene oxide; the CpG coding sequence is shown as SEQ ID NO 1; the novel coronavirus receptor binding region refers to a novel coronavirus S protein receptor binding region.
2. The coronavirus of claim 1, wherein the coronavirus is obtained by linking carnosine, CpG and a coronavirus receptor binding region on activated graphene oxide.
3. The method of producing a coronavirus according to claim 1, comprising the steps of:
obtaining CpG, a recombinant protein of a receptor binding region and carnosine, wherein the CpG coding sequence is shown as SEQ ID NO 1;
adding the graphene oxide freeze-dried powder into a phosphate buffer solution, and carrying out ultrasonic treatment;
adding EDC and NHS to activate the graphene oxide solution, removing excessive EDC/sulfo-NHS in the reaction solution through ultrafiltration, and adjusting the pH of the reaction solution to be neutral;
adding carnosine, CpG, and receptor binding region recombinant protein to a reaction solution, and incubating with activated graphene oxide;
excess unconjugated protein was removed from the reaction solution and sterilized for use.
4. The method of claim 3, wherein the duration of sonication is between 2 and 3 hours.
5. The method according to claim 3, wherein the phosphate buffer has a pH of 6.8 to 7.6.
6. The method of claim 3, wherein the method of removing excess EDC/sulfo-NHS or removing uncoupled proteins is ultrafiltration.
7. The method according to claim 3, wherein the amount of carnosine is 1.5 times or more the amount of graphene oxide, the amount of the receptor binding region is 2-10 times the amount of CpG, and the amount of CpG is one ten thousandth of graphene oxide, based on mass ratio.
8. The process according to any one of claims 3 to 7, wherein the reaction temperature is 20 to 28 ℃.
9. Use of a coronavirus according to claim 1, characterised in that said new corona vaccine is used for the preparation of a medicament for the prevention of a coronavirus.
10. The use of claim 9, wherein the coronavirus causes the body to produce antibodies to recombinant proteins of the receptor binding domain.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202011031367.1A CN112220919A (en) | 2020-09-27 | 2020-09-27 | Nano coronavirus recombinant vaccine taking graphene oxide as carrier |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202011031367.1A CN112220919A (en) | 2020-09-27 | 2020-09-27 | Nano coronavirus recombinant vaccine taking graphene oxide as carrier |
Publications (1)
Publication Number | Publication Date |
---|---|
CN112220919A true CN112220919A (en) | 2021-01-15 |
Family
ID=74107128
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN202011031367.1A Pending CN112220919A (en) | 2020-09-27 | 2020-09-27 | Nano coronavirus recombinant vaccine taking graphene oxide as carrier |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN112220919A (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2022126857A1 (en) * | 2020-12-17 | 2022-06-23 | 深圳先进技术研究院 | Use of two-dimensional nanomaterial in inhibition of coronavirus |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN111150841A (en) * | 2019-12-31 | 2020-05-15 | 优锐生物医药科技(深圳)有限公司 | Active immune regulation particle and preparation method and application thereof |
CN111603556A (en) * | 2020-04-26 | 2020-09-01 | 中山大学 | Preparation and application of novel coronavirus subunit nano vaccine |
CN111671890A (en) * | 2020-05-14 | 2020-09-18 | 苏州大学 | Novel coronavirus vaccine and application thereof |
- 2020
- 2020-09-27 CN CN202011031367.1A patent/CN112220919A/en active Pending
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN111150841A (en) * | 2019-12-31 | 2020-05-15 | 优锐生物医药科技(深圳)有限公司 | Active immune regulation particle and preparation method and application thereof |
CN111603556A (en) * | 2020-04-26 | 2020-09-01 | 中山大学 | Preparation and application of novel coronavirus subunit nano vaccine |
CN111671890A (en) * | 2020-05-14 | 2020-09-18 | 苏州大学 | Novel coronavirus vaccine and application thereof |
Non-Patent Citations (3)
Title |
---|
JINGYUN YANG等: "A vaccine targeting the RBD of the S protein of SARS-CoV-2 induces protective immunity", 《NATURE》 * |
MENG, CHUNCHUN等: "Graphene Oxides Decorated with Carnosine as an Adjuvant To Modulate Innate Immune and Improve Adaptive Immunity in Vivo", 《ACS NANO》 * |
曹凤强等: "氧化石墨烯纳米疫苗的免疫应答研究", 《国际生物医学工程杂志》 * |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2022126857A1 (en) * | 2020-12-17 | 2022-06-23 | 深圳先进技术研究院 | Use of two-dimensional nanomaterial in inhibition of coronavirus |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
EP0812209B1 (en) | Cochleate delivery vehicles for biologically relevant molecules | |
Sokolova et al. | The potential of nanoparticles for the immunization against viral infections | |
JP2001501640A (en) | vaccine | |
JP2002508333A (en) | vaccine | |
JP2019522020A (en) | Peptides with the ability to penetrate cell membranes | |
CN113769080B (en) | Polypeptide immunoconjugates and uses thereof | |
JP2003523401A (en) | A novel non-antigenic mucosal adjuvant formulation that modulates the effects of substances, including vaccine antigens, by contacting the mucosal body surface | |
KR101751376B1 (en) | Mucosal vaccine | |
JP5243624B2 (en) | Antigenic peptides and uses thereof | |
AU2011239941B2 (en) | Method of vaccination | |
TW202304955A (en) | Coronavirus vaccine formulations | |
CN112220919A (en) | Nano coronavirus recombinant vaccine taking graphene oxide as carrier | |
WO2004052395A1 (en) | L2-peptide of the human papillomavirus associated with virus-like particles | |
TW575427B (en) | Pharmaceutical composition for prevention or amelioration of Varicella or Zoster | |
CN101717433A (en) | Polypeptide immunogen, preparation method and application thereof | |
CA2521038C (en) | Polypeptide comprising cell adhesion motif, t cell epitope and b cell epitope for inducing antibody production | |
CA3121843A1 (en) | Virus-like particles of cmv modified by fusion | |
US9060984B2 (en) | Recombinant HIV-1 envelope proteins comprising stabilizing two-cysteine mini-domains in gp41 | |
JPWO2009001673A1 (en) | ATP-containing immune adjuvant | |
US20230355737A1 (en) | Particle comprising an rsv-f protein for use in rsv vaccination | |
JP2001505763A (en) | HIV P-17 peptide fragment, composition containing the same, and methods for producing and using the same | |
EP2683388A2 (en) | Vaccine formulation of mannose coated peptide particles | |
US20230414763A1 (en) | Transmucosal amphiphile-protein conjugate vaccine | |
CN102757500B (en) | Pegylation modifier of long-acting thymosin alpha1 | |
KR102301961B1 (en) | Amyloid conjugates and uses and methods thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
RJ01 | Rejection of invention patent application after publication | ||
RJ01 | Rejection of invention patent application after publication | Application publication date: 20210115 |